DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8745 and oat

DIOPT Version :9

Sequence 1:NP_648665.1 Gene:CG8745 / 39530 FlyBaseID:FBgn0036381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001304099.1 Gene:oat / 572518 ZFINID:ZDB-GENE-110411-148 Length:444 Species:Danio rerio


Alignment Length:463 Identity:128/463 - (27%)
Similarity:206/463 - (44%) Gaps:106/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QLFYRSD----------PLKIVRGQGQYMFDEEGTRYLDCIN--NVAHVGHCHPEVVRAGALQMA 86
            ::|.|.|          |:.:.||:|.:|:|.||.||.|.::  :..:.|||||:::.|...|.:
Zfish    47 EVFAREDRYGAHNYHPLPVALERGEGVHMWDVEGRRYFDFLSAYSAVNQGHCHPKIIAALTAQAS 111

  Fly    87 TIS-TNNRFLHDELVQCARTLT------SKMPEPLSVCFFVNSGSEANDLALRLARNFTKRQDVI 144
            .:: |:..|.:|.|....:.:|      ..:|        :|:|.|..:.|.:|||.:       
Zfish   112 RLTLTSRAFYNDILGAYEQYITGLFGYDKVLP--------MNTGVEGGETACKLARKW------- 161

  Fly   145 TLDHAYHGHLQSVMEVSPYKFNQPGGEAKPDY------------VHVAPCPDVYG--GKFTD--K 193
                ||     ||..:..|       |||..:            :..:..|..|.  |.|..  :
Zfish   162 ----AY-----SVKGIPKY-------EAKIVFAAGNFWGRTMAAISSSTDPSSYDGFGPFMPGFE 210

  Fly   194 MYPDADMGALYAQPIEEICQKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSAGGVC 258
            :.|..|:.||         :|.| :...||||:.|.:|...|.::|.|||.|.|.:.......:.
Zfish   211 LVPYNDIPAL---------EKAL-QDPHVAAFMVEPIQGEAGVVVPDAGYLQKVRELCTKYNVLF 265

  Fly   259 IADEVQVGFGRVGSHYWAFETQNVIPDIVCVAKPMGNG-HPVGAVVTTPEIAQAF----HATGVA 318
            ||||||.|..|.|... |.:.:.|.||:|.:.|.:..| :||.||:...|:....    |.    
Zfish   266 IADEVQTGLCRTGRRL-AVDHEAVRPDLVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHG---- 325

  Fly   319 YFNTYGGNPVSCAIANAVMRVIEEEGLQQKALVLGDYLLEECNRLKQEFECIGDVRGAGLFVGIE 383
              :||||||::|.:|.|.:.|:|||.|...|..:|..|..|.|:|.:|.  :..|||.||...| 
Zfish   326 --STYGGNPLACRVAIAALEVLEEENLAANAERMGQILRAELNKLPREI--VSGVRGKGLLNAI- 385

  Fly   384 LVQDRKERIPDKKAAHWVVNRMKQLHRVLVSSDGPNDNVIKLKPPMCFNRENADEFLLGFRECLT 448
            ::::.|:     ..|..|..|::....:...:.|   ::|:|.||:..|.:..       |||:.
Zfish   386 IIKETKD-----YDAWQVCLRLRDNGLLAKPTHG---DIIRLAPPLTINEQEV-------RECVE 435

  Fly   449 AVMQERLA 456
            .:.:..|:
Zfish   436 IISRTILS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8745NP_648665.1 GabT 20..450 CDD:223238 127/455 (28%)
OAT_like 37..447 CDD:99735 125/449 (28%)
oatNP_001304099.1 Orn_aminotrans 45..442 CDD:273853 127/460 (28%)
argD 59..441 CDD:273228 124/447 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145181at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.