DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8745 and oat

DIOPT Version :9

Sequence 1:NP_648665.1 Gene:CG8745 / 39530 FlyBaseID:FBgn0036381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001016936.1 Gene:oat / 549690 XenbaseID:XB-GENE-5969095 Length:439 Species:Xenopus tropicalis


Alignment Length:446 Identity:124/446 - (27%)
Similarity:195/446 - (43%) Gaps:87/446 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YRSDPLKIVRGQGQYMFDEEGTRYLDCIN--NVAHVGHCHPEVVRAGALQMATIS-TNNRFLHDE 98
            |...|:.:.||:|.|::|.||.||.|.::  :..:.|||||:::.|...|...:: |:..|.:|.
 Frog    55 YHPLPVALERGKGVYVWDVEGRRYFDFLSAYSAVNQGHCHPKILNALKAQADKLTLTSRAFYNDV 119

  Fly    99 LVQCARTLT------SKMPEPLSVCFFVNSGSEANDLALRLARNFT---------KRQDVITLDH 148
            |.:....:|      ..:|        :|:|.|..:.|.:|||.:.         |.|.:....:
 Frog   120 LGEYEEYVTKLFGYNKVLP--------MNTGVEGGETACKLARKWAYTVKGIPKYKAQIIFAAGN 176

  Fly   149 AYHGHLQSVMEVSPYKFNQPG-GEAKPDYVHVAPCPDVYGGKFTDKMYPDADMGALYAQPIEEIC 212
             :.|...|.:..|....:..| |...|.:                |:.|..|:.||         
 Frog   177 -FWGRTMSAISSSTDPSSYEGFGPFMPGF----------------KIIPYNDLPAL--------- 215

  Fly   213 QKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSAGGVCIADEVQVGFGRVGSHYWAF 277
             ::..:...||||:.|.:|...|.|:|..||...|.....:...:.||||||.|..|.|. ..|.
 Frog   216 -ERALQDPNVAAFMVEPIQGEAGVIVPDDGYLTGVRQLCTAHNVLFIADEVQTGLARTGK-MLAV 278

  Fly   278 ETQNVIPDIVCVAKPMGNG-HPVGAVVTTPEIAQAF----HATGVAYFNTYGGNPVSCAIANAVM 337
            :.:||.||||.:.|.:..| :||.||:...|:....    |.      :||||||::|.:|.|.:
 Frog   279 DHENVRPDIVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHG------STYGGNPLACRVAMASL 337

  Fly   338 RVIEEEGLQQKALVLGDYLLEECNRLKQEFECIGDVRGAGLFVGIELVQDRKERIPDKKAAHW-V 401
            .|||||.|.:.|..:|:.|..|.  :|...:.:..|||.||...|.:    ||   .|....| |
 Frog   338 EVIEEEKLAENATAMGELLRAEL--MKTPSDIVTAVRGKGLLNAIVI----KE---SKDCDAWKV 393

  Fly   402 VNRMKQLHRVLVSSDGPNDNVIKLKPPMCFNRENADEFLLGFRECLTAVMQERLAS 457
            ..|::....:...:.|   ::|:|.||:....:.       .||| |.::.:.|.|
 Frog   394 CLRLRDNGLLAKPTHG---DIIRLAPPLTIKEDE-------IREC-TEIIHKTLLS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8745NP_648665.1 GabT 20..450 CDD:223238 122/437 (28%)
OAT_like 37..447 CDD:99735 120/434 (28%)
oatNP_001016936.1 Orn_aminotrans 40..437 CDD:273853 122/443 (28%)
argD 54..436 CDD:273228 122/442 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D145181at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.