DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8745 and ABAT

DIOPT Version :9

Sequence 1:NP_648665.1 Gene:CG8745 / 39530 FlyBaseID:FBgn0036381 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001373544.1 Gene:ABAT / 18 HGNCID:23 Length:532 Species:Homo sapiens


Alignment Length:533 Identity:112/533 - (21%)
Similarity:192/533 - (36%) Gaps:150/533 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSKTETIKLRNQHIGQACQLFYRSDPLKIV----RGQGQYMFDEEGTRYLDCINNVAHV------ 70
            |.|||....|:|.:.:...:...::.:...    ..:|.|:.|.:|.|.||..:.::.|      
Human    45 LMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIEMVV 109

  Fly    71 ----------------------------GHCHPEVVR-AGALQMATISTNNRFL----HDELVQC 102
                                        |:.||.::: ....|.|::..|...|    .:..|:.
Human   110 SLCAAQAGLELLDSSDPPTLASQSARISGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEK 174

  Fly   103 AR-TLTSKMPEPLSVCFFVNSGSEANDLAL-----------RLARNFTKRQ-------------- 141
            .| :|.|..|:.:|....:..||.:|:.||           |..|.|::.:              
Human   175 LRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPD 239

  Fly   142 -DVITLDHAYHG---------HLQSVMEVSPYKFNQPGGEAKPDYVHVAPCPDVYGGKFTDKMYP 196
             .:::...|:||         |.:::.::....|:.|          :||.|.:        .||
Human   240 YSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWP----------IAPFPRL--------KYP 286

  Fly   197 -------DADMGALYAQPIEEICQKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSA 254
                   :....|...:.:|::..|...|.:.||..|.|.:||.||.......:|:.:.|..|..
Human   287 LEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDIARKH 351

  Fly   255 GGVCIADEVQVGFGRVGSHYWAFETQNV--IPDIVCVAKPMGNGHPVGAVVTTPEIAQAFH---- 313
            |...:.||||.|.|..|. :||.|...:  ..|::..:|.|..|             ..||    
Human   352 GCAFLVDEVQTGGGCTGK-FWAHEHWGLDDPADVMTFSKKMMTG-------------GFFHKEEF 402

  Fly   314 ATGVAY--FNTYGGNPVSCAIANAVMRVIEEEGLQQKALVLGDYLLEECNRLKQEF-ECIGDVRG 375
            .....|  |||:.|:|....:...|:.:|:.|.|...|...|..||.....|:..: :.|..|||
Human   403 RPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLLDLQARYPQFISRVRG 467

  Fly   376 AGLFVGIELVQDRKERIPDKKAAHWVVNRMKQLHRVLVSSD------GPNDNVIKLKPPMCFNRE 434
            .|.|...:...|.            :.|::     :|::.:      |..|..|:.:|.:.|...
Human   468 RGTFCSFDTPDDS------------IRNKL-----ILIARNKGVVLGGCGDKSIRFRPTLVFRDH 515

  Fly   435 NADEFLLGFRECL 447
            :|..||..|.:.|
Human   516 HAHLFLNIFSDIL 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8745NP_648665.1 GabT 20..450 CDD:223238 109/529 (21%)
OAT_like 37..447 CDD:99735 105/510 (21%)
ABATNP_001373544.1 GABAtrns_euk 34..528 CDD:129782 111/531 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.