powered by:
Protein Alignment Hml and AT2G20465
DIOPT Version :9
Sequence 1: | NP_524060.2 |
Gene: | Hml / 39529 |
FlyBaseID: | FBgn0029167 |
Length: | 3843 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_850000.1 |
Gene: | AT2G20465 / 816566 |
AraportID: | AT2G20465 |
Length: | 89 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 15/59 - (25%) |
Similarity: | 24/59 - (40%) |
Gaps: | 20/59 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 295 CAPTCA--PACQNGGQ------CISFNVCQ-----------CSKM-FRGDHCQYNIDRC 333
|.||.| |..:.|.| |.||:.|: |.:: |....|..::::|
plant 24 CLPTTARSPGYEIGPQRRRRVTCFSFSFCKPARGLASCDLFCKRLKFESGLCTGDLEKC 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D12226at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.