powered by:
Protein Alignment Hml and F53C11.9
DIOPT Version :9
Sequence 1: | NP_524060.2 |
Gene: | Hml / 39529 |
FlyBaseID: | FBgn0029167 |
Length: | 3843 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076745.1 |
Gene: | F53C11.9 / 4927055 |
WormBaseID: | WBGene00044921 |
Length: | 80 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 30/57 - (52%) |
Gaps: | 3/57 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1130 KCPLGQVFDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNED-GECVPKKMC 1185
:|...::|::||..|..:|:: |:. .|.:.|...|.|..|..|:.: .:|:..|.|
Worm 22 QCGENEIFNDCGSPCDRTCEN-PNP-MCIQMCKARCECKQGFVVDSNTKKCIDLKKC 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.