Sequence 1: | NP_524060.2 | Gene: | Hml / 39529 | FlyBaseID: | FBgn0029167 | Length: | 3843 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005373.2 | Gene: | NEFM / 4741 | HGNCID: | 7734 | Length: | 916 | Species: | Homo sapiens |
Alignment Length: | 506 | Identity: | 97/506 - (19%) |
---|---|---|---|
Similarity: | 156/506 - (30%) | Gaps: | 181/506 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1767 VRLNDEEK--------------VPRYDRMENVYGTCLKQYMTKVE---------------CRVKD 1802
Fly 1803 THEAPEQMDENVVC---------------------------SLEEGLRCIGKCHDYELRAFCQCD 1840
Fly 1841 EELEPE-----------LPKPTEKPQLGLACDAAVVEYKE-FPGDCHKF---------------- 1877
Fly 1878 -----------------LHCQPKGVEGGWIYVEKTCGE---YMMFNPTMLICDHIA-TVTEIKPN 1921
Fly 1922 CGLKPEPEPEFE---------PIKQCPPGKIKSE--------------------CANQC-ENTCH 1956
Fly 1957 YYGSILKKRGLCQVGEHCKPGCVDELRPDCPKLGKFWRDEDTCVHADECPCMDKAEHYVQPHKPV 2021
Fly 2022 LGEFEVCQCIDNAFTCVPNKP------EPVPKD--EDDDLDLVSVVPI-----YPVTLTP----- 2068
Fly 2069 --PLQCSPERLIPKIENPAHSLPDSIFNASSQLAP-EHGPKMARLTKEQPR 2116 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hml | NP_524060.2 | VWD | 485..636 | CDD:295339 | |
C8 | 680..754 | CDD:285899 | |||
TIL | 758..811 | CDD:280072 | |||
VWD | 840..1015 | CDD:214566 | |||
C8 | 1054..1121 | CDD:214843 | |||
TIL | 1131..1185 | CDD:280072 | |||
TIL | 1245..1298 | CDD:280072 | |||
VWD | 1327..1498 | CDD:214566 | |||
C8 | 1535..1609 | CDD:214843 | |||
Mucin2_WxxW | 1751..1837 | CDD:290069 | 25/125 (20%) | ||
TIL | 1938..2005 | CDD:280072 | 14/87 (16%) | ||
FA58C | 2089..2223 | CDD:238014 | 5/29 (17%) | ||
FA58C | 2104..2225 | CDD:214572 | 3/13 (23%) | ||
FA58C | <2299..2404 | CDD:214572 | |||
FA58C | <2299..2403 | CDD:238014 | |||
VWD | 2703..2858 | CDD:295339 | |||
C8 | 2893..2970 | CDD:285899 | |||
TIL | 2974..3030 | CDD:280072 | |||
VWD | 3035..3198 | CDD:295339 | |||
C8 | 3257..3313 | CDD:285899 | |||
VWC | 3397..3451 | CDD:302663 | |||
GHB_like | <3755..3813 | CDD:304424 | |||
NEFM | NP_005373.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
Head | 2..104 | ||||
Filament_head | 10..78 | CDD:282575 | |||
Filament | 100..411 | CDD:278467 | 33/176 (19%) | ||
Coil 1A | 105..136 | ||||
Linker 1 | 137..149 | ||||
Coil 1B | 150..248 | 4/13 (31%) | |||
Linker 12 | 249..265 | 3/15 (20%) | |||
Coil 2A | 266..287 | 4/20 (20%) | |||
Linker 2 | 288..291 | 0/2 (0%) | |||
Coil 2B | 292..412 | 22/119 (18%) | |||
Tail | 413..916 | 63/327 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 485..851 | 52/252 (21%) | |||
6 X 13 AA approximate tandem repeats of K-S-P-V-[PS]-K-S-P-V-E-E-[KA]-[GAK] | 614..691 | 19/78 (24%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |