powered by:
Protein Alignment Hml and F32D8.3
DIOPT Version :9
Sequence 1: | NP_524060.2 |
Gene: | Hml / 39529 |
FlyBaseID: | FBgn0029167 |
Length: | 3843 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505772.1 |
Gene: | F32D8.3 / 185205 |
WormBaseID: | WBGene00009328 |
Length: | 245 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 22/53 - (41%) |
Similarity: | 29/53 - (54%) |
Gaps: | 6/53 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1246 YAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANC 1298
:..|:.||.: .||.|.|.| .|.|.|||.|..|:|.::.:| ||||..|
Worm 66 FQSFSHCACE--STCNNPDPY---CSKCEPGCTCRNGFVRNSLKL-CVLPEEC 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1216 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.