Sequence 1: | NP_524060.2 | Gene: | Hml / 39529 | FlyBaseID: | FBgn0029167 | Length: | 3843 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017170432.1 | Gene: | Coch / 12810 | MGIID: | 1278313 | Length: | 555 | Species: | Mus musculus |
Alignment Length: | 282 | Identity: | 59/282 - (20%) |
---|---|---|---|
Similarity: | 85/282 - (30%) | Gaps: | 88/282 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 805 CITR----------ELCP--CSLRGKEFKPESTVKKNCNTCTCKNGQWRCTEDKCGARC--GAVG 855
Fly 856 DPHYQTFDG--KRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRF 918
Fly 919 ILRDGTPSVIKLDQGLTTIVNDKP--------------------------IAKLPKMLGLG---- 953
Fly 954 EVLIRRASS----TFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPE 1014
Fly 1015 GDVETAVEP----FADKWRTKD 1032 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hml | NP_524060.2 | VWD | 485..636 | CDD:295339 | |
C8 | 680..754 | CDD:285899 | |||
TIL | 758..811 | CDD:280072 | 3/15 (20%) | ||
VWD | 840..1015 | CDD:214566 | 42/212 (20%) | ||
C8 | 1054..1121 | CDD:214843 | |||
TIL | 1131..1185 | CDD:280072 | |||
TIL | 1245..1298 | CDD:280072 | |||
VWD | 1327..1498 | CDD:214566 | |||
C8 | 1535..1609 | CDD:214843 | |||
Mucin2_WxxW | 1751..1837 | CDD:290069 | |||
TIL | 1938..2005 | CDD:280072 | |||
FA58C | 2089..2223 | CDD:238014 | |||
FA58C | 2104..2225 | CDD:214572 | |||
FA58C | <2299..2404 | CDD:214572 | |||
FA58C | <2299..2403 | CDD:238014 | |||
VWD | 2703..2858 | CDD:295339 | |||
C8 | 2893..2970 | CDD:285899 | |||
TIL | 2974..3030 | CDD:280072 | |||
VWD | 3035..3198 | CDD:295339 | |||
C8 | 3257..3313 | CDD:285899 | |||
VWC | 3397..3451 | CDD:302663 | |||
GHB_like | <3755..3813 | CDD:304424 | |||
Coch | XP_017170432.1 | LCCL | 35..117 | CDD:128866 | 25/103 (24%) |
vWA_collagen_alphaI-XII-like | 169..333 | CDD:238759 | 23/126 (18%) | ||
vWA_collagen | 371..532 | CDD:238749 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1216 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |