DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and IRC24

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:56/226 - (24%)
Similarity:94/226 - (41%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAG--MIVVGLARRHERVEKLRSG----------LSLEQQSRLH 59
            ||.:::|||.|||....:.:|...  .||.|:||....::.|:..          |.:..:||:.
Yeast     3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSRME 67

  Fly    60 AIKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGII----GTGELSERDDGPAMRSTIETNIMGT 120
            |:..:|.|:.             |.:|.:|:|||::    ...:.:...|........:.|....
Yeast    68 ALVEEIRQKH-------------GKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSI 119

  Fly   121 VYCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALR--AMNEIYRQEFQ 183
            |..|......:|.....|::|.|:|.|..:..|      ..:.|..:|.||.  || :|..:|  
Yeast   120 VSLVALCLPLLKSSPFVGNIVFVSSGASVKPYN------GWSAYGCSKAALNHFAM-DIASEE-- 175

  Fly   184 RHKTAVRVSTVSPGIVDTVILPEQIQGIIKQ 214
             ....||...::||:|||     |:|..|::
Yeast   176 -PSDKVRAVCIAPGVVDT-----QMQKDIRE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 56/226 (25%)
NADB_Rossmann 1..247 CDD:304358 56/226 (25%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.