DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and AT1G10310

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_563866.1 Gene:AT1G10310 / 837570 AraportID:AT1G10310 Length:242 Species:Arabidopsis thaliana


Alignment Length:204 Identity:50/204 - (24%)
Similarity:91/204 - (44%) Gaps:24/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQV 71
            :..:::|.|.|:|.|....|...|..|:|.||..|::..|:|.||......|  :..|:.....|
plant    18 RTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSSSTNHLL--LTADVKSNSSV 80

  Fly    72 LKAFDWTCRQLGGVDVLVSNAGIIGTG----ELSERDDGPAMRSTIETNIMGTVYCVRESFRSM- 131
            .:.......:.|..|::|:|||.|...    |:|..|    ..:.::||:.|....:|.....| 
plant    81 EEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAED----FDNVMDTNVKGVANVLRHFIPLML 141

  Fly   132 -KRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVS 195
             :::|     :|||..:|:.........|    |.|:|:|:..::....:|...   .:.|..::
plant   142 PRKQG-----IIVNMSSGWGRSGAALVAP----YCASKWAIEGLSRAVAKEVVE---GMAVVALN 194

  Fly   196 PGIVDTVIL 204
            ||:::|.:|
plant   195 PGVINTELL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 50/204 (25%)
NADB_Rossmann 1..247 CDD:304358 50/204 (25%)
AT1G10310NP_563866.1 SDR_c 20..>205 CDD:212491 50/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.