DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and NOL

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_568145.1 Gene:NOL / 830372 AraportID:AT5G04900 Length:348 Species:Arabidopsis thaliana


Alignment Length:201 Identity:57/201 - (28%)
Similarity:94/201 - (46%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQVLKA 74
            :::|::.|||.|..|..:.||..||..:|..||||.....|..|....:...|||:|:...|.:.
plant    83 LITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVREL 147

  Fly    75 FDWTCRQLGGVDVLVSNAG-----IIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRSMKRR 134
            ..::.:.|..:|:.::|||     .....|.|:.|    :...::||.:|.:.|.||:...|..:
plant   148 VAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDED----LIEVVKTNTLGLMLCCREAMNMMLTQ 208

  Fly   135 GTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTA-VRVSTVSPGI 198
            ...||:..::. ||..    |...|....|.|||.::..:.:..:.|.|..... |.|..:|||:
plant   209 SRGGHIFNIDG-AGSD----GRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGM 268

  Fly   199 VDTVIL 204
            |.|.:|
plant   269 VTTDLL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 57/201 (28%)
NADB_Rossmann 1..247 CDD:304358 57/201 (28%)
NOLNP_568145.1 adh_short 81..276 CDD:278532 57/201 (28%)
SDR_c 82..302 CDD:212491 57/201 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.