DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and NYC1

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_567400.1 Gene:NYC1 / 826942 AraportID:AT4G13250 Length:496 Species:Arabidopsis thaliana


Alignment Length:277 Identity:68/277 - (24%)
Similarity:121/277 - (43%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIGAACTRALIGAGMIVVGLARRHERV-------------------EKLRSGLSLEQQ 55
            |::|::.|:|.|..|..:.:|..|:..:|..|.|                   |..|..||   .
plant   165 VITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLS---D 226

  Fly    56 SRLHAIKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTG-----ELSERDDGPAMRSTIET 115
            :::..|.||:.:.:.|.|..::..::||.:::.::||| ...|     |.:|.|    :...:.|
plant   227 AKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAG-TNKGFRPLLEFTEED----ITQIVST 286

  Fly   116 NIMGTVYCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQ 180
            |::|::.|.|.:...|.|:.:.||:..::. ||    :.|...|...:|.:||..||..:....:
plant   287 NLIGSILCTRGAMDVMSRQHSGGHIFNMDG-AG----SGGSSTPLTAVYGSTKCGLRQFHGSIVK 346

  Fly   181 EFQRHKTAVRVSTVSPGIVDTVI------------------LPEQIQGIIKQHMPMLRSDDVADA 227
            |.|  ||.|.:.|.|||:|.|.:                  |||.:...:...|.:::....|..
plant   347 ESQ--KTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVN 409

  Fly   228 VLWAIGTPPNVQVHNIT 244
            .|    |||.:.:..:|
plant   410 YL----TPPRILLAIVT 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 68/277 (25%)
NADB_Rossmann 1..247 CDD:304358 68/277 (25%)
NYC1NP_567400.1 SDR_c 164..395 CDD:212491 61/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm1174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.