DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and DHRS11

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_077284.2 Gene:DHRS11 / 79154 HGNCID:28639 Length:260 Species:Homo sapiens


Alignment Length:262 Identity:89/262 - (33%)
Similarity:149/262 - (56%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGL-SLEQQSRLHAIKCD 64
            ||||.:::|:|:|||.|||||..|||:..|:.|||.||....:|:|.:.. |......|...:||
Human     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD 70

  Fly    65 ITQEDQVLKAFDWTCRQLGGVDVLVSNAGI-----IGTGELSERDDGPAMRSTIETNIMGTVYCV 124
            ::.|:.:|..|.....|..|||:.::|||:     :.:|..|      ..:.....|::....|.
Human    71 LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTS------GWKDMFNVNVLALSICT 129

  Fly   125 RESFRSMKRRGT-EGHVVIVNSVAGYQV-PNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKT 187
            ||:::|||.|.. :||::.:||::|::| |     |...:.|.|||:|:.|:.|..|||.:..:|
Human   130 REAYQSMKERNVDDGHIININSMSGHRVLP-----LSVTHFYSATKYAVTALTEGLRQELREAQT 189

  Fly   188 AVRVSTVSPGIVDTVIL-------PEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITI 245
            .:|.:.:|||:|:|...       ||:.....:| |..|:.:|||:||::.:.||.::|:.:|.:
Human   190 HIRATCISPGVVETQFAFKLHDKDPEKAAATYEQ-MKCLKPEDVAEAVIYVLSTPAHIQIGDIQM 253

  Fly   246 KP 247
            :|
Human   254 RP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 89/262 (34%)
NADB_Rossmann 1..247 CDD:304358 88/260 (34%)
DHRS11NP_077284.2 Mgc4172-like_SDR_c 6..256 CDD:187601 89/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143375
Domainoid 1 1.000 154 1.000 Domainoid score I4257
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3916
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm40752
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.