DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and zgc:153724

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001038910.1 Gene:zgc:153724 / 751735 ZFINID:ZDB-GENE-060825-275 Length:131 Species:Danio rerio


Alignment Length:99 Identity:42/99 - (42%)
Similarity:61/99 - (61%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRS-----GLSLEQQSRLHA 60
            |:||..:||:|:|||||||||..::|:..||.|:|.||..||:|.|.:     |.:    ..|..
Zfish     1 MDRWIGRVALVTGASAGIGAAVAKSLVQRGMKVIGCARNVERIENLATECVDCGFT----GSLFP 61

  Fly    61 IKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGI 94
            .|||::.|:::...|.|...|..||||.::|||:
Zfish    62 YKCDLSVEEEISSMFAWIKAQHKGVDVCINNAGL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 42/99 (42%)
NADB_Rossmann 1..247 CDD:304358 42/99 (42%)
zgc:153724NP_001038910.1 NADB_Rossmann 1..>115 CDD:304358 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.