DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and BDH1

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_011511369.1 Gene:BDH1 / 622 HGNCID:1027 Length:347 Species:Homo sapiens


Alignment Length:277 Identity:73/277 - (26%)
Similarity:122/277 - (44%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIV-VGLARR---HERVEKLRSGLSLEQQSRLHAIKCDIT 66
            :|..:|:|..:|.|.:..:.|...|.:| .|...:   |:.|::|.|    ....||..::.::.
Human    59 SKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDS----LNSDRLRTVQLNVC 119

  Fly    67 QEDQVLKAFDWTCRQL----GGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRES 127
            ..::|.|..:.....|    .|:..||:||||...||: |.......:...|.|:.|||. :.:|
Human   120 SSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEV-EFTSLETYKQVAEVNLWGTVR-MTKS 182

  Fly   128 FRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVS 192
            |..:.|| .:|.||.::|:.| ::.|     |:.:.|..|||.:.|.::..|  ::.:...|:||
Human   183 FLPLIRR-AKGRVVNISSMLG-RMAN-----PARSPYCITKFGVEAFSDCLR--YEMYPLGVKVS 238

  Fly   193 TVSPG---IVDTVILPEQIQGIIK---QHMP-MLRSD-------------------------DVA 225
            .|.||   ...::..||.||.|.|   :.:| ::|.|                         .|.
Human   239 VVEPGNFIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVI 303

  Fly   226 DAVLWAI-GTPPNVQVH 241
            |||..|: .|.|..:.|
Human   304 DAVTHALTATTPYTRYH 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 73/277 (26%)
NADB_Rossmann 1..247 CDD:304358 73/277 (26%)
BDH1XP_011511369.1 type2_17beta_HSD-like_SDR_c 60..345 CDD:187665 73/276 (26%)
adh_short 60..245 CDD:278532 56/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.