Sequence 1: | NP_648664.2 | Gene: | CG8757 / 39528 | FlyBaseID: | FBgn0036380 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018493.1 | Gene: | dhrs7cb / 553684 | ZFINID: | ZDB-GENE-050522-226 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 83/197 - (42%) | Gaps: | 20/197 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLR----SGLSLEQQSRLHAIKCDIT 66
Fly 67 QEDQVLKAFDWTCRQLGGVDVLVSNAGI---IGTGELSERDDGPAMRSTIETNIMGTVYCVRESF 128
Fly 129 RSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVST 193
Fly 194 VS 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8757 | NP_648664.2 | YdfG | 1..252 | CDD:226674 | 51/197 (26%) |
NADB_Rossmann | 1..247 | CDD:304358 | 51/197 (26%) | ||
dhrs7cb | NP_001018493.1 | 11beta-HSD1_like_SDR_c | 35..309 | CDD:187593 | 51/197 (26%) |
adh_short | 38..219 | CDD:278532 | 48/193 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |