DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and dhrs7cb

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001018493.1 Gene:dhrs7cb / 553684 ZFINID:ZDB-GENE-050522-226 Length:324 Species:Danio rerio


Alignment Length:197 Identity:51/197 - (25%)
Similarity:83/197 - (42%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLR----SGLSLEQQSRLHAIKCDIT 66
            |||.|::.|.:|:|:.|.|.....|..:|......:::|.|.    ||....|......:..|.:
Zfish    37 NKVVVITDAVSGMGSECARLFHAGGARLVLCGPSWDKLESLYDSLCSGSDPSQTFTPKLVLLDFS 101

  Fly    67 QEDQVLKAFDWTCRQLGGVDVLVSNAGI---IGTGELSERDDGPAMRSTIETNIMGTVYCVRESF 128
            ..:.:.......|...|.||||:.|:.:   .....||...|    ::.::.|..|.:...:...
Zfish   102 DMENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMD----KTIMDVNYFGPITLAKGVL 162

  Fly   129 RSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVST 193
            ..|..|.| |..|:|||:.|...      ||....|.|:|.|::|..:..|.|.:  :..:.|||
Zfish   163 PLMITRRT-GQFVLVNSIQGKLA------LPFRTCYAASKHAVQAFFDCLRAEVE--EFGISVST 218

  Fly   194 VS 195
            :|
Zfish   219 IS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 51/197 (26%)
NADB_Rossmann 1..247 CDD:304358 51/197 (26%)
dhrs7cbNP_001018493.1 11beta-HSD1_like_SDR_c 35..309 CDD:187593 51/197 (26%)
adh_short 38..219 CDD:278532 48/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.