DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and dhrs7b

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_021326304.1 Gene:dhrs7b / 550454 ZFINID:ZDB-GENE-050417-277 Length:316 Species:Danio rerio


Alignment Length:264 Identity:75/264 - (28%)
Similarity:122/264 - (46%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRAL--IGAGMIVVGLARR--HERVEKLRSGLSLEQQSRLH-AIKCDI 65
            :||.|::|||:|:|..|.|..  .||.:|:.|..:|  .|.||:||:....:.|:... .:..|:
Zfish    44 DKVVVITGASSGLGKECARVFHAAGARLILCGRDQRRLQEVVEELRNKTYGKTQTYTPCTVTFDL 108

  Fly    66 TQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRS 130
            :....|..|.....:..|.:|||::|||:...|.:.:.... ..|..:|||..|.|...:....|
Zfish   109 SNTSVVCSAAAEILKCHGHIDVLINNAGVSYRGNILDTHVS-VQREVMETNYFGPVALTQAILPS 172

  Fly   131 MKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVS 195
            |..||: ||:|:::||.|      ...:|..:.|.|:|.|::|..:..|.|..  ...:.||.:|
Zfish   173 MVDRGS-GHIVVISSVQG------KISIPYRSAYAASKHAMQAYYDCLRAEVD--SLGLHVSVLS 228

  Fly   196 PGIVDTVILPEQIQGIIKQHMPMLRSD-------DVADAVLWAI----------GTPPNVQVHNI 243
            ||.|.|.:....:.|...::..|.|:.       |||..:|.|:          |..|...::..
Zfish   229 PGYVRTNMSINAVTGDGSKYGVMDRTTATGADPVDVAKDILKAVCQKKKDVVMAGLGPTTAIYLR 293

  Fly   244 TIKP 247
            |:.|
Zfish   294 TLWP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 75/264 (28%)
NADB_Rossmann 1..247 CDD:304358 74/262 (28%)
dhrs7bXP_021326304.1 11beta-HSD1_like_SDR_c 42..303 CDD:187593 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.