DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and dhrs7

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001015708.1 Gene:dhrs7 / 549350 XenbaseID:XB-GENE-5838792 Length:336 Species:Xenopus tropicalis


Alignment Length:220 Identity:62/220 - (28%)
Similarity:101/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGL----SLEQQSRLHAIKCDITQE 68
            |..|:|||:|||...:..|...|..:|..:||...:.:::...    |||.|..| .:..|:||.
 Frog    52 VVWVTGASSGIGEELSYQLAKIGCPLVLSSRRETELLRVKQKCLEISSLEDQDIL-ILPLDMTQT 115

  Fly    69 DQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERD-----DGPAMRSTIETNIMGTVYCVRESF 128
            ....:|.:...:..|.:|:||:|||      .|:|.     :....|:.||.|.:||:...:...
 Frog   116 SMHKEATEKALQHFGRIDILVNNAG------RSQRSLFVETNLDVFRALIELNYLGTISITKHVL 174

  Fly   129 RSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVST 193
            :.|..| .:|.:|.::||.|.    :|..|.|  .|.|:|.||:......|.|...:...: :|.
 Frog   175 QHMIER-KQGKIVNISSVVGL----IGAPLSS--GYSASKHALQGFFNSLRTELTAYPDII-ISN 231

  Fly   194 VSPGIVDTVILP-------EQIQGI 211
            :.||.|.:.|:.       |::|.|
 Frog   232 ICPGPVQSKIVENALTEECEKVQSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 62/220 (28%)
NADB_Rossmann 1..247 CDD:304358 62/220 (28%)
dhrs7NP_001015708.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.