DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and RDH8

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:291 Identity:79/291 - (27%)
Similarity:122/291 - (41%) Gaps:83/291 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAGMIVVGLA----RRHERVEKLR-----------SGLSLEQQS 56
            :..::||.|:|||..          :.|.||    :|::.|..:|           :|.:|.|  
Human     6 RTVLISGCSSGIGLE----------LAVQLAHDPKKRYQVVATMRDLGKKETLEAAAGEALGQ-- 58

  Fly    57 RLHAIKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDG---PAMRSTIETNIM 118
            .|...:.|:..::.|.:..  :|.| |.|||||:|||:...|.|    :|   .||::..:||..
Human    59 TLTVAQLDVCSDESVAQCL--SCIQ-GEVDVLVNNAGMGLVGPL----EGLSLAAMQNVFDTNFF 116

  Fly   119 GTVYCVRESFRSMKRRGTEGHVVIVNSVAGYQ--VPNLGPQLPSLNIYPATKFALRAMNE---IY 178
            |.|..|:.....|||| .:||:|:::||.|.|  :.|        ::|.|:||||....|   |.
Human   117 GAVRLVKAVLPGMKRR-RQGHIVVISSVMGLQGVIFN--------DVYAASKFALEGFFESLAIQ 172

  Fly   179 RQEFQRHKTAVRVSTVSPGIVDTVIL----------------PEQIQGIIKQHMPMLRS------ 221
            ..:|.     :.:|.|.||.|.|...                ||.:......::|..|.      
Human   173 LLQFN-----IFISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVG 232

  Fly   222 ---DDVADAVLWAIGT--PPNVQVHNITIKP 247
               .||..|::..|.:  ||..:..||...|
Human   233 QNPQDVVQAIVNVISSTRPPLRRQTNIRYSP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 79/291 (27%)
NADB_Rossmann 1..247 CDD:304358 78/289 (27%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 78/288 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.