DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and dhrs11

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_012816490.1 Gene:dhrs11 / 496708 XenbaseID:XB-GENE-6048420 Length:255 Species:Xenopus tropicalis


Alignment Length:262 Identity:99/262 - (37%)
Similarity:150/262 - (57%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQS-----RLHA 60
            ||||..:||:|:|||.|||||..|.|:..||.|||.||..:::||    |:.|.||     .|..
 Frog     1 MERWKGRVALVTGASVGIGAAVARVLVQHGMKVVGCARSVDKIEK----LAAECQSAGYPGTLFP 61

  Fly    61 IKCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGE-LSERDDGPAMRSTIETNIMGTVYCV 124
            .|||::.|:::|..|........||||.::|||:..... ||.:.:|  .|:.|:.|::....|.
 Frog    62 YKCDLSNEEEILSMFSAIKTLHQGVDVCINNAGLARPEPLLSGKTEG--WRTMIDVNVLALSICT 124

  Fly   125 RESFRSMKRRG-TEGHVVIVNSVAG--YQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHK 186
            ||:::|||.|. .:||::.:|||.|  ||...      ..:.|.|||..:.|:.|..|||.:..|
 Frog   125 REAYQSMKERNIDDGHIININSVLGHIYQCAK------QAHFYCATKHTVTALTEAIRQELRELK 183

  Fly   187 TAVRVSTVSPGIVDTVIL------PEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITI 245
            :.:||:::|||:|:|...      ...|...:.:.:..|...|:|:|||:|:||||:||||.:.:
 Frog   184 SHIRVTSISPGLVETEFAYRCFENDPSIAATLYKSIKCLDPGDIANAVLYALGTPPHVQVHEMIV 248

  Fly   246 KP 247
            :|
 Frog   249 RP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 99/262 (38%)
NADB_Rossmann 1..247 CDD:304358 98/260 (38%)
dhrs11XP_012816490.1 Mgc4172-like_SDR_c 1..251 CDD:187601 99/262 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133750
Inparanoid 1 1.050 162 1.000 Inparanoid score I4110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47935
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.