DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG7601

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:256 Identity:60/256 - (23%)
Similarity:113/256 - (44%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRS---GLSLEQQSRLHAIKCDITQE 68
            ||.:::|||:|:|.:.......||..|:..|||.:.:|:::.   .|.::.......:..|:.:.
  Fly    54 KVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAEL 118

  Fly    69 DQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIM-----GTVYCVRESF 128
            :.:.:...........||:|::|.||      |.|.|..:....::..:|     |:|...:...
  Fly   119 NSIPEFVTRVLAVYNQVDILINNGGI------SVRADVASTAVDVDLKVMVVNYFGSVALTKALL 177

  Fly   129 RSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVST 193
            .||.:||: ||:..::||.|...      :|....|.|:|.|::|..:..|.|.....  :.||.
  Fly   178 PSMVKRGS-GHICFISSVQGKFA------IPQRAAYSASKHAMQAFADSLRAEVANKN--INVSC 233

  Fly   194 VSPGIVDTVILPEQIQG-------IIKQHMPMLRSDDVADAVLWAI-GTPPNVQVHNITIK 246
            ||||.:.|.:....:.|       :.:.....:..|.:|:.:|..| ...|::.|.::..|
  Fly   234 VSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEPDIIVSDVQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 60/256 (23%)
NADB_Rossmann 1..247 CDD:304358 60/256 (23%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 60/256 (23%)
PRK06181 53..314 CDD:235726 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.