DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG5590

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:71/177 - (40%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VSGASAGIG--AACTRALIGAGMIVVG-LARRH-----------ERVEKLRSGLSLEQQSRLHAI 61
            ::|||.|||  .|...|..||.::|.. .|..|           |.:||  :|      .:.:..
  Fly    14 ITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEK--AG------GKAYPC 70

  Fly    62 KCDITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNI--MGTVYCV 124
            ..|:..|.||..|.:....:.||:|::::||..|   .|:...|....|..:..||  .|| :.|
  Fly    71 VVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAI---SLTNTPDTDMKRYDLMHNINTRGT-FLV 131

  Fly   125 RESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFAL 171
            .:......::....|::.::.....:....||.:    .|...|:.:
  Fly   132 SKVCLPYLKKSNHAHILNISPPLSMKPKWFGPHV----AYTMAKYGM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 41/177 (23%)
NADB_Rossmann 1..247 CDD:304358 41/177 (23%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 41/177 (23%)
PRK08278 7..277 CDD:181349 41/177 (23%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.