DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG3301

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:257 Identity:119/257 - (46%)
Similarity:171/257 - (66%) Gaps:12/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDI 65
            |.||.|:||||:||||||||||.|.|:..||:|||||||.:.::.::|.|..:|.:|.|...||:
  Fly     1 MNRWLNRVAVVTGASAGIGAACCRDLVAKGMVVVGLARREKVLQDIKSSLPADQAARFHTRPCDV 65

  Fly    66 TQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRS 130
            :.|.||:..|.|..|.|||.||||:|||||....:::.::...:|:.::.|::|..:|.|:.|.|
  Fly    66 SNEQQVIDTFAWIDRTLGGADVLVNNAGIIRQMNITDPENSADVRAILDVNVLGVTWCTRQWFLS 130

  Fly   131 MKRRG-TEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTV 194
            ::||. .:||||::|||.|:.||.:  :..|||:|..:|.|:.|:.||.||||.:..|..:::::
  Fly   131 LQRRKVNDGHVVVINSVVGHSVPAV--EGFSLNMYAPSKHAITALTEILRQEFIKKGTQTKITSI 193

  Fly   195 SPGIVDTVILP----EQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITIKPQGEKF 252
            |||:|.|.|..    ||..|     ||||||:|:||||.:.|.|||.||:..:.|||.||.|
  Fly   194 SPGVVATEIFEAGSWEQPTG-----MPMLRSEDIADAVTYCIQTPPTVQIKELIIKPVGEGF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 118/255 (46%)
NADB_Rossmann 1..247 CDD:304358 114/250 (46%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 118/255 (46%)
NADB_Rossmann 1..245 CDD:304358 114/250 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442651
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1010.000

Return to query results.
Submit another query.