DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG31546

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:273 Identity:66/273 - (24%)
Similarity:113/273 - (41%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTR--ALIGAGMIVVGLARRHERVEKLRSGL------SLEQQSRLHAIKC 63
            ||.:::||::|||||...  :.:||.:.:|      :|.|:   ||      .::.....:.|..
  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALV------DREEE---GLICVMKRCMKMGHEPYGIAG 69

  Fly    64 DITQEDQV-LKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRES 127
            |:.:..:: ..|...|.|..|.:||||:.|||:.||.| :..:.......:|.|:....|..:..
  Fly    70 DLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTL-QSTELACFTHVMEANVRSGFYLTKLL 133

  Fly   128 FRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRH------K 186
            ...:.:  .:|.:|.|:||.|.:.      .|:|..|..:|.|:        .:|.|.      .
  Fly   134 LPQLLQ--CKGSIVNVSSVCGLRA------FPNLVAYNMSKAAV--------DQFTRSLALDLGP 182

  Fly   187 TAVRVSTVSPGIVDTVILPEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQ------------ 239
            ..|||:.|:||::.|.:  ::..|:.:|..............|..||.|..|.            
  Fly   183 QGVRVNAVNPGVIRTNL--QKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELAS 245

  Fly   240 -VHNITIKPQGEK 251
             |..:|:...|.|
  Fly   246 FVTGVTLPVDGGK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 66/273 (24%)
NADB_Rossmann 1..247 CDD:304358 64/267 (24%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 64/270 (24%)
NADB_Rossmann 11..261 CDD:304358 66/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.