DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:232 Identity:66/232 - (28%)
Similarity:110/232 - (47%) Gaps:25/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIG--AACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDI---TQED 69
            :|:|||.|||  .|...|.:||.:::.  |||...:|::.|........:...|..|:   :..|
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVIT--ARRGNVLEQVVSKCREMGAQKAFYIPADMANPSDAD 99

  Fly    70 QVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERD-DGPAMRSTIETNIMGTVYCVRESFRSMKR 133
            .|:|   :...||||:|.||.|.  ||.......| |....|..:|.|.:..:...:::..::::
Zfish   100 LVVK---YAIEQLGGLDYLVLNH--IGPSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEK 159

  Fly   134 RGTEGHVVIVNSVAGYQVPNLGP-QLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVSPG 197
              ::|.:|:|:|:.|   ...|| .||    |.:|||||.......:.|....|:.|.::....|
Zfish   160 --SKGSIVVVSSLLG---KICGPFALP----YASTKFALNGFFGGLQNELAMQKSNVSITICILG 215

  Fly   198 IVDTVILPEQIQGIIKQHMPMLRSDDVADAVLWAIGT 234
            ::||....|:|:|.|  :|....|.:.|..::.|..|
Zfish   216 LIDTDSAMEKIKGYI--NMTAYPSHEAALQIIQAGAT 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 66/232 (28%)
NADB_Rossmann 1..247 CDD:304358 66/232 (28%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 66/232 (28%)
adh_short 36..229 CDD:278532 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.