DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and HSD11B1L

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:208 Identity:49/208 - (23%)
Similarity:90/208 - (43%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIG--AACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQVL 72
            :::||:||:|  .|...|.:|:.:::.  |.....::|:..........::..|..|:...:...
Human    80 LLTGANAGVGEELAYHYARLGSHLVLT--AHTEALLQKVVGNCRKLGAPKVFYIAADMASPEAPE 142

  Fly    73 KAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGP-AMRSTIETNIMGTVYCVRESFRSMKRRGT 136
            ....:...:|||:|.||.|.  ||......|...| |.|..::.|.:..|.....:..|:  ..:
Human   143 SVVQFALDKLGGLDYLVLNH--IGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSL--TDS 203

  Fly   137 EGHVVIVNSVAGYQVPNLGPQLPSLNI-YPATKFALRAMNEIYRQEFQRHKTAVRVSTVSPGIVD 200
            :|.:|:|:|:.| :||.      |.:. |.|.||||.......|:|.......|.::....|:.|
Human   204 KGSLVVVSSLLG-RVPT------SFSTPYSAAKFALDGFFGSLRRELDVQDVNVAITMCVLGLRD 261

  Fly   201 TVILPEQIQGIIK 213
            .....|.::|:.:
Human   262 RASAAEAVRGVTR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 49/208 (24%)
NADB_Rossmann 1..247 CDD:304358 49/208 (24%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 49/208 (24%)
PRK08251 78..302 CDD:181324 49/208 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.