DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and ZK697.14

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001024318.1 Gene:ZK697.14 / 3565013 WormBaseID:WBGene00022809 Length:249 Species:Caenorhabditis elegans


Alignment Length:207 Identity:52/207 - (25%)
Similarity:93/207 - (44%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIGAACTRALI-GAGM-IVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQVL 72
            :::||:.|||....:..: ..|: :|:...|...:.::|.|    ...|||.....:|..:|.:.
 Worm     7 LITGANRGIGLGLVKQFLKNEGIQLVIATCRNPSKADELNS----IADSRLQIFPLEIDCDDSIK 67

  Fly    73 KAFDWTCRQLG--GVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESF------R 129
            |.::.....:|  |:.||::||.|....|:..:.....||..||||.:.|. .:.::|      .
 Worm    68 KLYENVDTLVGTDGLTVLINNAAICSVYEIEGQISRTYMRQQIETNSVSTA-ILTQNFIPLLKKA 131

  Fly   130 SMKRRGTE---GHVVIVNSVAG-YQVPNLGPQLPSLNI-YPATKFALRAMNEIYRQEFQRHKTAV 189
            |.|..|.|   ....|||..:| ..:..:..:.|.:.| |..:|.||.:.::....|..::.  :
 Worm   132 SAKNGGEEYSTDRAAIVNISSGAASIGYIDDKQPGIYIAYRMSKSALNSFSKSCSVELAKYH--I 194

  Fly   190 RVSTVSPGIVDT 201
            .|:.:.||.|.|
 Worm   195 LVTAMCPGWVKT 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 52/207 (25%)
NADB_Rossmann 1..247 CDD:304358 52/207 (25%)
ZK697.14NP_001024318.1 carb_red_sniffer_like_SDR_c 6..248 CDD:187586 52/207 (25%)
adh_short 6..211 CDD:278532 52/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.