DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and HSD17B1

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001317148.1 Gene:HSD17B1 / 3292 HGNCID:5210 Length:329 Species:Homo sapiens


Alignment Length:227 Identity:66/227 - (29%)
Similarity:101/227 - (44%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGL-SLEQQSRL----HAIKC---- 63
            |.:::|.|:|||.          .:.|.||....:..|:.:.| .|:.|.||    .|:.|    
Human     5 VVLITGCSSGIGL----------HLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGS 59

  Fly    64 ------DITQEDQVLKAFDWTCRQLGGVDVLVSNA--GIIGTGELSERDDGPAMRSTIETNIMGT 120
                  |:.....|..|.:....  |.|||||.||  |::|..|....|   |:.|.::.|::||
Human    60 LETLQLDVRDSKSVAAARERVTE--GRVDVLVCNAGLGLLGPLEALGED---AVASVLDVNVVGT 119

  Fly   121 VYCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNE---IYRQEF 182
            |..::.....|||||: |.|::..||.|.    :|  ||..::|.|:||||..:.|   :....|
Human   120 VRMLQAFLPDMKRRGS-GRVLVTGSVGGL----MG--LPFNDVYCASKFALEGLCESLAVLLLPF 177

  Fly   183 QRHKTAVRVSTVSPGIVDTVIL------PEQI 208
            ..|.    :|.:..|.|.|..:      ||::
Human   178 GVHS----LSLIECGPVHTAFMEKVLGSPEEV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 66/227 (29%)
NADB_Rossmann 1..247 CDD:304358 66/227 (29%)
HSD17B1NP_001317148.1 NADB_Rossmann 4..262 CDD:304358 66/227 (29%)
adh_short 5..198 CDD:278532 64/218 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.