DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG31937

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:215 Identity:57/215 - (26%)
Similarity:92/215 - (42%) Gaps:27/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEK-----LRSGLSLEQQSRLHAIKCDIT 66
            :|..::|||:|||.|...:|...|:.:|..|||.|::|:     |.:...|.....:..|:.|:.
  Fly    47 QVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDML 111

  Fly    67 QEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAM-----RSTIETNIMGTVYCVRE 126
            ..|:.....:........:||||:|||      .|:|.....:     |...|.::...|:..|.
  Fly   112 DLDEHKTHLNTVLNHFHRLDVLVNNAG------RSQRASWTEVEIEVDRELFELDVFAVVHLSRL 170

  Fly   127 SFR-SMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVR 190
            ..| .:::.|..||:...:|:||:.      .:|....|.|.|.||.|    |....:.....:.
  Fly   171 VVRYFVEQNGGRGHIAATSSIAGFS------PVPFSPTYCAAKHALNA----YLLSLKVEMRKLD 225

  Fly   191 VSTVSPGIVDTVILPEQIQG 210
            ||..:||.:.|..|.|...|
  Fly   226 VSLFAPGPIATDFLQEAFTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 57/215 (27%)
NADB_Rossmann 1..247 CDD:304358 57/215 (27%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 57/215 (27%)
adh_short 47..245 CDD:278532 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.