DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG31548

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:205 Identity:57/205 - (27%)
Similarity:92/205 - (44%) Gaps:25/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQE 68
            :..||.:::|||:|||||........|..:....|..|.::|:.:..|...||:...:..||.:|
  Fly     3 FAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKE 67

  Fly    69 DQVLKAFDWTCRQLGGVDVLVSNAGIIGTG-------ELSERDDGPAMRSTIETNIMGTVYCVRE 126
            ....:.:..|.:|.|.:||||:|||||.||       |..:|.....:|:.....::.|...|: 
  Fly    68 ADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK- 131

  Fly   127 SFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRV 191
                     |:|::|.|:||.|.:      ..|.:..|..:|..:.........|..  ...|||
  Fly   132 ---------TKGNIVNVSSVNGIR------SFPGVLAYNISKMGVDQFTRCVALELA--AKGVRV 179

  Fly   192 STVSPGIVDT 201
            :.|:||:..|
  Fly   180 NCVNPGVTVT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 57/205 (28%)
NADB_Rossmann 1..247 CDD:304358 57/205 (28%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 57/205 (28%)
NADB_Rossmann 3..253 CDD:304358 57/205 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.