DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG10962

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:257 Identity:122/257 - (47%)
Similarity:177/257 - (68%) Gaps:13/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDI 65
            |:||.|:|||:||||:||||||.|.|:.||:.|||||||.:|:|:||..|..||:.|.|..|||:
  Fly     1 MDRWQNRVAVISGASSGIGAACARLLVAAGLQVVGLARRTDRLEQLRQSLPAEQRMRFHQHKCDV 65

  Fly    66 TQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPA--MRSTIETNIMGTVYCVRESF 128
            :||.||..||:|..::|||:|||::||||:..|:|.   |.|.  :.:.::||:||::||.:.:.
  Fly    66 SQELQVDTAFEWIEKELGGIDVLINNAGIVLGGQLI---DMPTKDINNILQTNLMGSIYCTKLAA 127

  Fly   129 RSMKRRGTEGHVVIVNS---VAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVR 190
            .||:||...||::.|||   ||||: |:  |...|||.|..:||||.|:.||.|||.....:.::
  Fly   128 SSMRRRQVAGHLIFVNSTAGVAGYK-PD--PADESLNAYTPSKFALTAVQEICRQELINQGSKIK 189

  Fly   191 VSTVSPGIVDTVILPEQIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITIKPQGEKF 252
            .::::||.|.|.|:|::.:.  |....:|::||||.|||:|:.|||:.||..||::..||.|
  Fly   190 TTSINPGWVATEIVPDETKA--KLGEVILQADDVAQAVLYALSTPPHTQVEQITLRAVGEYF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 121/255 (47%)
NADB_Rossmann 1..247 CDD:304358 119/250 (48%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 121/255 (47%)
NADB_Rossmann 1..243 CDD:304358 119/249 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442637
Domainoid 1 1.000 86 1.000 Domainoid score I2775
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45743
OrthoDB 1 1.010 - - D101130at6960
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - mtm6354
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
1110.910

Return to query results.
Submit another query.