DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG3699

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:128/262 - (48%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQE-D 69
            |||.:|:|||:|||||..:.|...|..:..:.|....:|..:..|   :.::...:..|:|:: |
  Fly     5 NKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVTKDAD 66

  Fly    70 QVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRSMKRR 134
            .:::.   |..:.|.:||||:||||:|.|.|.:.|. ....:.:.||:.|.:...:.....:.: 
  Fly    67 AIVQQ---TLAKFGRIDVLVNNAGILGKGGLIDLDI-EEFDAVLNTNLRGVILLTKAVLPHLLK- 126

  Fly   135 GTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVSPGIV 199
             |:|.||.|:|.||     :.|...:|: |..:|.||....:|...|..  ...|||::|:||.|
  Fly   127 -TKGAVVNVSSCAG-----IRPFAGALS-YGVSKAALDQFTKIVALEMA--PQGVRVNSVNPGFV 182

  Fly   200 DT------VILPEQIQGIIKQHM---PMLRSDD---VADAVLWAIGT----------PPNVQVHN 242
            .|      .|:.|:..|::::.:   ||.|..|   ||:||.:...:          |.:...||
  Fly   183 VTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHN 247

  Fly   243 IT 244
            :|
  Fly   248 LT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 76/262 (29%)
NADB_Rossmann 1..247 CDD:304358 76/262 (29%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 73/255 (29%)
NADB_Rossmann 3..248 CDD:304358 74/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.