DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and CG13377

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:253 Identity:54/253 - (21%)
Similarity:103/253 - (40%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIG-AACTRALIGAGMIVVGLARRHERV-EKLRSG-LSLEQQSR------LHAI 61
            ::|.:::.|...:| ..||........:..|:....:.: .||..| :.:.:.|.      :..:
  Fly    45 SRVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSEEPIAGTIIPM 109

  Fly    62 KCDITQEDQVLKAFDWTCRQLG----GVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVY 122
            :.|:|:||.:.:|.......|.    |:..:::.:|.:..|:: |..:.......:.|||:||:.
  Fly   110 RLDVTREDVLREATVIIGANLNADERGIAAVINTSGSVFRGQV-ESQNVQQWEHMLRTNILGTLR 173

  Fly   123 CVRESFRSMKRRGTEGHVVIVNSVA-GYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHK 186
             |.::|... .|.|.|.::.:..|: |....|.|..|.:.|   |::.|:....|..|:|.  |.
  Fly   174 -VAKAFVCF-LRPTRGRLLYLGGVSGGGNARNEGDGLVAFN---ASRVAVDKCAEELRKEL--HP 231

  Fly   187 TAVRV-----------STVSPGIVDTVILPEQIQGIIKQHMPMLRSDD---VADAVLW 230
            ..|.|           |.....:..|:.|   :.|...|:...:.|.|   |.:..||
  Fly   232 YGVSVVALDTCGMTAESLYKAPVAQTMSL---VVGAPTQYTADVLSPDALHVIERALW 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 54/253 (21%)
NADB_Rossmann 1..247 CDD:304358 54/253 (21%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 44/207 (21%)
NADB_Rossmann 46..>237 CDD:304358 43/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.