DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and Dhrs7

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001258323.1 Gene:Dhrs7 / 299135 RGDID:1565002 Length:338 Species:Rattus norvegicus


Alignment Length:242 Identity:61/242 - (25%)
Similarity:102/242 - (42%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEK-----LRSGLSLEQQSRLHAIKCDITQ 67
            |..::|||:|||......|...|:.:|..|||.:.:|:     |.:| :|:::..| .:..|:|.
  Rat    52 VVWITGASSGIGEELAFQLSKLGVCLVLSARRGQELERVKRRCLENG-NLKEKDIL-VLPLDLTD 114

  Fly    68 EDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNI-----------MGTV 121
            ......|.....::.|.:|:||:|.|      .|:|.      ..:|||:           :|||
  Rat   115 TSSHEAATKAVLQEFGKIDILVNNGG------RSQRS------LVLETNLEVFKELMNLNYLGTV 167

  Fly   122 YCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNI---YPATKFALRAMNEIYRQEFQ 183
            ...:.....|..| .:|.:|.|||:||         :.|:::   |.|:|.|||........|..
  Rat   168 SLTKCVLPHMVER-KQGKIVTVNSLAG---------IASVSLSSGYCASKHALRGFFNALHSELG 222

  Fly   184 RHKTAVRVSTVSPGIVDTVILPEQIQ-GIIKQHM------PMLRSDD 223
            ::          |||....:.|..:| .::|..:      ||..:.|
  Rat   223 KY----------PGITLCNVYPGPVQSNVVKNALTEELTKPMRENID 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 61/242 (25%)
NADB_Rossmann 1..247 CDD:304358 61/242 (25%)
Dhrs7NP_001258323.1 11beta-HSD1_like_SDR_c 48..308 CDD:187593 61/242 (25%)
adh_short 52..250 CDD:278532 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.