Sequence 1: | NP_648664.2 | Gene: | CG8757 / 39528 | FlyBaseID: | FBgn0036380 | Length: | 252 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011522088.1 | Gene: | DHRS7B / 25979 | HGNCID: | 24547 | Length: | 334 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 57/202 - (28%) |
---|---|---|---|
Similarity: | 100/202 - (49%) | Gaps: | 17/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRL-----HAIKCDI 65
Fly 66 TQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRS 130
Fly 131 M-KRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTV 194
Fly 195 SPGIVDT 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8757 | NP_648664.2 | YdfG | 1..252 | CDD:226674 | 57/202 (28%) |
NADB_Rossmann | 1..247 | CDD:304358 | 57/202 (28%) | ||
DHRS7B | XP_011522088.1 | 11beta-HSD1_like_SDR_c | 97..>304 | CDD:187593 | 57/202 (28%) |
adh_short | 101..294 | CDD:278532 | 56/200 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |