DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and SPCC162.03

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_588241.1 Gene:SPCC162.03 / 2539382 PomBaseID:SPCC162.03 Length:292 Species:Schizosaccharomyces pombe


Alignment Length:192 Identity:53/192 - (27%)
Similarity:97/192 - (50%) Gaps:16/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQVLKA 74
            :::|:|.|:|.|..:..:..|..|:..:|..:.:       ::| .|:|..:|.|:|....|..|
pombe     9 LITGSSKGLGYALVKVGLAQGYNVIACSRAPDTI-------TIE-HSKLLKLKLDVTDVKSVETA 65

  Fly    75 FDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRSMKRRGTEGH 139
            |....|:.|.||::::|||....||. |..:...|...:..|..|..|..:|:...|:..|..|.
pombe    66 FKDAKRRFGNVDIVINNAGYGLVGEF-ESYNIEEMHRQMNVNFWGVAYITKEALNLMRESGKGGR 129

  Fly   140 VVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVSPGIVDT 201
            ::.::||||| .|:     |.|::|.|:|||:..:::...:|...:.. :.::.|.||.:.|
pombe   130 ILQISSVAGY-YPS-----PCLSMYNASKFAVEGLSQTIMRELDPNWN-IAITIVQPGGMQT 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 53/192 (28%)
NADB_Rossmann 1..247 CDD:304358 53/192 (28%)
SPCC162.03NP_588241.1 17beta-HSD-like_SDR_c 7..248 CDD:187632 53/192 (28%)
PRK08263 9..257 CDD:181334 53/192 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I1885
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.