DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and Dhrs7b

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_663403.1 Gene:Dhrs7b / 216820 MGIID:2384931 Length:323 Species:Mus musculus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:119/266 - (44%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLH---AIKCDITQ 67
            |.|.||:||::|:|..|.:....||..:|...|..:.:|:|...|:...|.:.|   .:..|:..
Mouse    52 NAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLAD 116

  Fly    68 EDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSER----DDGPAMRSTIETNIMGTVYCVRESF 128
            ...:..|.....:..|.||||::||||...|.:|:.    |     |..:|.|..|.|...:...
Mouse   117 PGTIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVD-----RKVMEINYFGPVALTKALL 176

  Fly   129 RSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVST 193
            .||..| .:||:|.::|:.|      ...:|..:.|.|:|.|.:|..:..|.|.:  :..::|:.
Mouse   177 PSMVER-KQGHIVAISSIQG------KISIPFRSAYSASKHATQAFFDCLRAEME--EANIKVTV 232

  Fly   194 VSPGIVDTVILPEQI------QGIIKQHMPMLRS-DDVADAVLWAIGTP----------PNVQVH 241
            :|||.:.|.:....:      .|.:.::....|| .:||..|..|:|..          |::.|:
Mouse   233 ISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVY 297

  Fly   242 NITIKP 247
            ..|:.|
Mouse   298 IRTLAP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 70/266 (26%)
NADB_Rossmann 1..247 CDD:304358 69/264 (26%)
Dhrs7bNP_663403.1 11beta-HSD1_like_SDR_c 50..309 CDD:187593 70/266 (26%)
PRK06181 52..319 CDD:235726 70/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.