DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and DHRS7C

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001207422.1 Gene:DHRS7C / 201140 HGNCID:32423 Length:312 Species:Homo sapiens


Alignment Length:224 Identity:62/224 - (27%)
Similarity:98/224 - (43%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGL-SLEQQSR-----------L 58
            |||.|::.|.:|:|..|.|.....|..:|...:..||:|.|...| |:...|:           |
Human    37 NKVVVITDAISGLGKECARVFHTGGARLVLCGKNWERLENLYDALISVADPSKQTFTPKLVLLDL 101

  Fly    59 HAIKC--DITQEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAMRSTIE------- 114
            ..|.|  |:.:|  ||..:       |.||:|::||.:        :..|||.:.::|       
Human   102 SDISCVPDVAKE--VLDCY-------GCVDILINNASV--------KVKGPAHKISLELDKKIMD 149

  Fly   115 TNIMGTVYCVRESFRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYR 179
            .|..|.:...:....:|..|.| |.:|:||::.|    ..|  :|....|.|:|.|.....:..|
Human   150 ANYFGPITLTKALLPNMISRRT-GQIVLVNNIQG----KFG--IPFRTTYAASKHAALGFFDCLR 207

  Fly   180 QEFQRHKTAVRVSTVSPGIVDTV-ILPEQ 207
            .|.:.:.  |.:|||||..:.:. :.|||
Human   208 AEVEEYD--VVISTVSPTFIRSYHVYPEQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 62/224 (28%)
NADB_Rossmann 1..247 CDD:304358 62/224 (28%)
DHRS7CNP_001207422.1 11beta-HSD1_like_SDR_c 35..297 CDD:187593 62/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.