DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and Dhrs11

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_808232.2 Gene:Dhrs11 / 192970 MGIID:2652816 Length:260 Species:Mus musculus


Alignment Length:260 Identity:93/260 - (35%)
Similarity:151/260 - (58%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWCNKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGL-SLEQQSRLHAIKCD 64
            ||||.:::|:|:|||.|||||..|||:..|:.|||.||....:|:|.:.. |......|...:||
Mouse     6 MERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD 70

  Fly    65 ITQEDQVLKAFDWTCRQLGGVDVLVSNAGI-----IGTGELSERDDGPAMRSTIETNIMGTVYCV 124
            ::.|:.:|..|.....|..|||:.::|||:     :.:|..|      ..:.....|::....|.
Mouse    71 LSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTS------GWKDMFNVNVLALSICT 129

  Fly   125 RESFRSMKRRG-TEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTA 188
            ||:::|||.|. .:||::.:||:.|::||   || ..::.|.|||:|:.|:.|..|||....:|.
Mouse   130 REAYQSMKERNIDDGHIININSMCGHRVP---PQ-SVIHFYSATKYAVTALTEGLRQELLEAQTH 190

  Fly   189 VRVSTVSPGIVDTVI---LPEQIQG---IIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITIKP 247
            :|.:.:|||:|:|..   |.::..|   ...:|:..||.:|||:||::.:.|||:|||.:|.::|
Mouse   191 IRATCISPGLVETQFAFKLHDKDPGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDIQMRP 255

  Fly   248  247
            Mouse   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 93/260 (36%)
NADB_Rossmann 1..247 CDD:304358 92/258 (36%)
Dhrs11NP_808232.2 YdfG 6..259 CDD:226674 93/260 (36%)
Mgc4172-like_SDR_c 6..256 CDD:187601 93/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833543
Domainoid 1 1.000 151 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3893
Isobase 1 0.950 - 0 Normalized mean entropy S2090
OMA 1 1.010 - - QHG45743
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm42824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.