DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and T25G12.13

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001257285.1 Gene:T25G12.13 / 13224720 WormBaseID:WBGene00219274 Length:310 Species:Caenorhabditis elegans


Alignment Length:267 Identity:72/267 - (26%)
Similarity:122/267 - (45%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLS----LEQQSRLHAIKCDIT 66
            ||:.|::|||:|:|.:....|...|..|:.|||..|:::::.:.|:    |.:....:.. .|||
 Worm    46 NKIVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICAELTKTFPLNKNKPTYYF-FDIT 109

  Fly    67 QEDQVLKAFDWTCRQLGGVDVLVSNAGIIGTGELSERDDGPAM-RSTIETNIMGTVYCVRESFRS 130
            ..|:.    .|.  |:..||||::|||:...|  |.:|...|: |..:|||:.|.|. |.:|.  
 Worm   110 NPDKA----PWA--QIPKVDVLINNAGMSNRG--SCQDTTMAIHRKAMETNLFGHVQ-VTQSL-- 163

  Fly   131 MKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVSTVS 195
            :.:...:|.:|:.:|:.|...      :|....|.|:|.||:...:..|.|   ||. :.:..||
 Worm   164 LSKLSPDGCIVVTSSIQGKVA------IPYRGSYSASKHALQGYFDCLRAE---HKN-LHILVVS 218

  Fly   196 PGIVDT------------VILPE---QIQGIIKQHMPMLRSDDVADAVLWAIGTPPNVQVHNITI 245
            .|.::|            |:..|   |.:|...:|...:.||.:.|            :|.:..:
 Worm   219 AGYINTGFGSRALDTDGKVVGVEDENQKKGYSPEHSARMISDAIRD------------RVSDFDM 271

  Fly   246 KPQGEKF 252
            .|.|.:|
 Worm   272 APFGARF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 71/265 (27%)
NADB_Rossmann 1..247 CDD:304358 69/260 (27%)
T25G12.13NP_001257285.1 NADB_Rossmann 44..290 CDD:304358 72/267 (27%)
PRK06181 46..289 CDD:235726 72/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.