DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8757 and hsd11b1l.2

DIOPT Version :9

Sequence 1:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_004910661.1 Gene:hsd11b1l.2 / 100038278 XenbaseID:XB-GENE-5834068 Length:291 Species:Xenopus tropicalis


Alignment Length:204 Identity:57/204 - (27%)
Similarity:96/204 - (47%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVAVVSGASAGIGAACTRALIGAGMIVVGLARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQ- 70
            |..:::|:|.|||..........|..::..||||:|::::.:     |..:|.|...|....|. 
 Frog    34 KRVLITGSSTGIGEQIAYEFAQMGAHIMLTARRHQRLQEVAN-----QCLKLGAASADYVASDMG 93

  Fly    71 VLKAFDW----TCRQLGGVDVLVSNAGIIGTGELS----ERDDGPAMRSTIETNIMGTVYCVRES 127
            .|.:..:    |.::|||:|.||.|.  || |..|    :.|..|.:.| |..|.:..|.....:
 Frog    94 NLTSAQYVAQETVKKLGGLDYLVLNH--IG-GSASFGFFKGDMDPVVGS-ITINFLSYVQLTSTA 154

  Fly   128 FRSMKRRGTEGHVVIVNSVAGYQVPNLGPQLPSLNIYPATKFALRAMNEIYRQEFQRHKTAVRVS 192
            .|:::.  ::|.:|:::|::|    .:|  .|....|.|:||||.......|:||...|..:.|:
 Frog   155 LRALQE--SQGSIVVMSSMSG----RIG--APFTTSYCASKFALEGFYSSLRREFDLQKNNMSVT 211

  Fly   193 TVSPGIVDT 201
            ....|.:||
 Frog   212 VAILGYIDT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8757NP_648664.2 YdfG 1..252 CDD:226674 57/204 (28%)
NADB_Rossmann 1..247 CDD:304358 57/204 (28%)
hsd11b1l.2XP_004910661.1 11beta-HSD1_like_SDR_c 31..280 CDD:187593 57/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.