DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru3 and AT2G47310

DIOPT Version :9

Sequence 1:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_850472.1 Gene:AT2G47310 / 819344 AraportID:AT2G47310 Length:512 Species:Arabidopsis thaliana


Alignment Length:316 Identity:69/316 - (21%)
Similarity:103/316 - (32%) Gaps:129/316 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LKPAENESRSEHLD---RKLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGP-DGASKGCAFVK 87
            |:...::|.:::.|   .||:|..:||..||.|:||:|..:|.:.|..:.:.. .|......|:|
plant    93 LRKRRSQSATDNADGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGERAAYCFIK 157

  Fly    88 FGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKER--------------QIRRMQQMAGHMN 138
            :...:|..:||..|....|.||....:.|::|:.|:||              .:|.:.:....|.
plant   158 YKKVEEGNAAIAALTEQFTFPGEMLPVKVRFAEAERERIGFAPVQLPDNPKLYVRCLNKQTTKME 222

  Fly   139 LLNPFVFNQFSPYG----------------AYAQQQQQAALMAAAATAPGSAAAYMNPMAALATQ 187
                 |...||.||                .||..|.....||.||         :..:..|.| 
plant   223 -----VNEVFSRYGIIEDIYMALDDMKICRGYAFVQFSCKEMALAA---------IKALNGLFT- 272

  Fly   188 IPHGLNGTGQP-------PSLP-----------SPTMPNFNMGANTPN--GQPGGAAAAAAAAAA 232
                :.|:.||       |..|           .|.|.:|:     ||  .||            
plant   273 ----IRGSDQPLIVRFADPKKPRLGEQRSTFNTPPAMQHFD-----PNWHSQP------------ 316

  Fly   233 ADGVFTNGIPQ-----------------TAFPGH--------------PLHLTIPP 257
                    .||                 ::.|.|              |||..|||
plant   317 --------YPQWENKEPAPPRVVQHHDFSSQPNHFPHQNTQAVSEVHKPLHQDIPP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043 25/83 (30%)
ELAV_HUD_SF 43..404 CDD:273741 65/297 (22%)
RRM3_CELF3_4_5_6 319..397 CDD:241083
AT2G47310NP_850472.1 RRM_SF 111..190 CDD:418427 24/78 (31%)
RRM_SF 208..287 CDD:418427 19/97 (20%)
WW 406..432 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3741
eggNOG 1 0.900 - - E1_KOG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.