DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru3 and shep

DIOPT Version :9

Sequence 1:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:360 Identity:86/360 - (23%)
Similarity:135/360 - (37%) Gaps:95/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KYADTEKERQIRRM-----QQM----AGHMNLLNPFVFNQFSPYGAYAQQQQQAALMAAAATAPG 172
            :|:.....:|.::|     ||.    .|.:::..|....|..|....:|.....:..:|||....
  Fly     4 RYSPAPPPQQQQQMGGPPHQQQGGGGGGGVSMRGPSNAQQLPPQIPRSQNYSNGSSSSAAAAPLT 68

  Fly   173 SAAAYMN-PMAALATQIPHGLNGTGQPPSLPSPT-----------MPNFNMGANTPNG-QPGGAA 224
            |.:|:.. |:.|.|..:...|  ..:||::.||.           .|.....:.||.| .|..||
  Fly    69 SRSAFPGAPLTASAVALKGAL--PQRPPAMTSPAAAAAGAALAAGAPYRGAASWTPQGYAPAAAA 131

  Fly   225 AAAAAAAAADGVFTNGIPQTAFPGHPLHLTIPPQGLPNGDAATLQHAFPGLPPFPGVAFPAVYGQ 289
            ||||.|..|...:|..:||.|:..:..|....|        ||...:|        ::.|..|..
  Fly   132 AAAAVAQQAAYRYTAPLPQPAYAAYTPHTATTP--------ATTTVSF--------LSQPVDYYW 180

  Fly   290 FPQALPPPLAAVAPTQREDFLMFPGCSIS-----------------GPEG--------------- 322
            :.|.:|   .|.:|:...........|.|                 ||.|               
  Fly   181 YGQRVP---TAASPSNTNSSSSSNTGSQSGTLSTSLSNTTNTNTNMGPNGTVQNQNQQGGEQLSK 242

  Fly   323 CNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGF 387
            .||:|..|.|...|.:|:.|...:|.:||:|..:|:.||:.|.:|||.|:.||.|:.|::.:.|.
  Fly   243 TNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK 307

  Fly   388 QIGMKRLKVQLKRPKDASRPYXQSEFLKRNSQQPT 422
            .:                    |::..|:..|.||
  Fly   308 GV--------------------QAQMAKQQEQDPT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043 1/2 (50%)
ELAV_HUD_SF 43..404 CDD:273741 81/340 (24%)
RRM3_CELF3_4_5_6 319..397 CDD:241083 28/92 (30%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 26/89 (29%)
RRM2_MSSP 322..400 CDD:240690 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.