DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru3 and Pof

DIOPT Version :9

Sequence 1:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001246498.1 Gene:Pof / 37947 FlyBaseID:FBgn0035047 Length:495 Species:Drosophila melanogaster


Alignment Length:116 Identity:30/116 - (25%)
Similarity:48/116 - (41%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLKPAENESRSEHLDR-KLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGPDGASK-----GCA 84
            :|||..:|.::|.:|. .|:||.:....|...::..|        ...:|...|..|     ..|
  Fly   199 ELKPFSDEEQAEFIDPCSLYVGNIPFNMTTSAIKAYF--------ANAMRVDIGVLKREKRARYA 255

  Fly    85 FVKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAG 135
            ||::.|..:...|...|..|   |..|.:|.|:|         ||:::.||
  Fly   256 FVRYASPDQTMEAFKELVDS---PLNSRTLTVRY---------RRLRKRAG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043 21/85 (25%)
ELAV_HUD_SF 43..404 CDD:273741 24/98 (24%)
RRM3_CELF3_4_5_6 319..397 CDD:241083
PofNP_001246498.1 RRM <201..>292 CDD:223796 27/110 (25%)
RRM_SF 217..285 CDD:240668 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.