DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru3 and Celf2

DIOPT Version :9

Sequence 1:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_038951514.1 Gene:Celf2 / 29428 RGDID:68347 Length:546 Species:Rattus norvegicus


Alignment Length:438 Identity:189/438 - (43%)
Similarity:249/438 - (56%) Gaps:81/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MNRALQLKPAENESRSEHLDRKLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGPDGASKGCAF 85
            |:..:|:|||::|..:...|||||:||:||:..|:|:|.:|.|||.||||.|||||||.|:||||
  Rat   140 MHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAF 204

  Fly    86 VKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRM-QQMAGHMNLLNPFVFNQF- 148
            |.|.::..||:||..:|.||||.|.||.:|||:|||:|:::.||: ||:|..|..||...:... 
  Rat   205 VTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLT 269

  Fly   149 -------------------SPYGAYA-----------QQQQQAALMAAAATAPGSA-AAYMNPMA 182
                               |..||::           |.|..|.|.||||.|..|| :...||::
  Rat   270 GLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANPLS 334

  Fly   183 ALATQIPHGLNGTGQPPSLPSPTMPNFNMGANTPNGQPGGAAAAAAAAAAADGVF---------- 237
            :.::.:          .:|.||      :.|:|||...|.|..:..:.....|:.          
  Rat   335 STSSAL----------GALTSP------VAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNIN 383

  Fly   238 ----TNGIPQTAFPGHPLHLTIPPQGLPNGDAAT---LQHAFPGLPPFPGVAFPAVYGQFPQALP 295
                |..|.|.......|:..:...||.||.|.|   |..|:.|:..:...|.|.:|.   |:|.
  Rat   384 ALAGTISIAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYS---QSLL 445

  Fly   296 PPLAAVAPTQREDFLMFPGCSISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRAT 360
            ...:| |.:|:|           ||||.|||||||||||||.:::|||:|||||||:|||||:.|
  Rat   446 QQQSA-AGSQKE-----------GPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQT 498

  Fly   361 NQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDASRPY 408
            |.||||||||:|||.|||||||||||||||||||||||||.|:.|:||
  Rat   499 NLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043 49/79 (62%)
ELAV_HUD_SF 43..404 CDD:273741 177/410 (43%)
RRM3_CELF3_4_5_6 319..397 CDD:241083 65/77 (84%)
Celf2XP_038951514.1 RRM1_CELF1_2_Bruno 67..150 CDD:410040 4/9 (44%)
RRM2_CELF1_2 159..239 CDD:410042 49/79 (62%)
RRM3_CELF1_2 454..545 CDD:241082 74/101 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54704
OrthoDB 1 1.010 - - D1209165at2759
OrthoFinder 1 1.000 - - FOG0000286
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X208
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.