DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bru3 and CELF2

DIOPT Version :9

Sequence 1:NP_001369050.1 Gene:bru3 / 39527 FlyBaseID:FBgn0264001 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_024303540.1 Gene:CELF2 / 10659 HGNCID:2550 Length:549 Species:Homo sapiens


Alignment Length:438 Identity:189/438 - (43%)
Similarity:248/438 - (56%) Gaps:81/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MNRALQLKPAENESRSEHLDRKLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGPDGASKGCAF 85
            |:..:|:|||::|..:...|||||:||:||:..|:|:|.:|.|||.||||.|||||||.|:||||
Human   143 MHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAF 207

  Fly    86 VKFGSQQEAQSAITNLHGSQTMPGASSSLVVKYADTEKERQIRRM-QQMAGHMNLLNPFVFNQF- 148
            |.|.::..||:||..:|.||||.|.||.:|||:|||:|:::.||: ||:|..|..||...:... 
Human   208 VTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLT 272

  Fly   149 -------------------SPYGAYA-----------QQQQQAALMAAAATAPGSA-AAYMNPMA 182
                               |..||::           |.|..|.|.||||.|..|| :...||::
Human   273 GLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANPLS 337

  Fly   183 ALATQIPHGLNGTGQPPSLPSPTMPNFNMGANTPNGQPGGAAAAAAAAAAADGVF---------- 237
            ..::.:          .:|.||      :.|:|||...|.|..:..:.....|:.          
Human   338 TTSSAL----------GALTSP------VAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNIN 386

  Fly   238 ----TNGIPQTAFPGHPLHLTIPPQGLPNGDAAT---LQHAFPGLPPFPGVAFPAVYGQFPQALP 295
                |..|.|.......|:..:...||.||.|.|   |..|:.|:..:...|.|.:|.   |:|.
Human   387 ALAGTINIAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYS---QSLL 448

  Fly   296 PPLAAVAPTQREDFLMFPGCSISGPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRAT 360
            ...:| |.:|:|           ||||.|||||||||||||.:::|||:|||||||:|||||:.|
Human   449 QQQSA-AGSQKE-----------GPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQT 501

  Fly   361 NQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDASRPY 408
            |.||||||||:|||.|||||||||||||||||||||||||.|:.|:||
Human   502 NLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bru3NP_001369050.1 RRM2_CELF3_4_5_6 40..120 CDD:410043 49/79 (62%)
ELAV_HUD_SF 43..404 CDD:273741 177/410 (43%)
RRM3_CELF3_4_5_6 319..397 CDD:241083 65/77 (84%)
CELF2XP_024303540.1 RRM1_CELF1_2_Bruno 70..153 CDD:241075 4/9 (44%)
RRM2_CELF1_2 162..242 CDD:241078 49/79 (62%)
RRM3_CELF1_2 457..548 CDD:241082 74/101 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54704
OrthoDB 1 1.010 - - D1209165at2759
OrthoFinder 1 1.000 - - FOG0000286
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X208
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.