DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgi and VGLL4

DIOPT Version :9

Sequence 1:NP_729916.1 Gene:Tgi / 39521 FlyBaseID:FBgn0036373 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001121691.1 Gene:VGLL4 / 9686 HGNCID:28966 Length:296 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:82/244 - (33%) Gaps:103/244 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 PQEEPLPLSLAL--HRTQTPPSPP---------------------------------PSATGSAP 399
            |:.:.||::.||  |||..||..|                                 .:|.|...
Human    36 PRIQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCR 100

  Fly   400 ALPTAVSQ-VMEAAVAGRRILDTPHHTPPRYNTPPPPPPAYGI----------------AGTTVV 447
            ..|...|: .:|.|||....|...|    .|.:    .|:.|:                ||   :
Human   101 RDPRERSRSPIERAVAPTMSLHGSH----LYTS----LPSLGLEQPLALTKNSLDASRPAG---L 154

  Fly   448 APTLTPTPTPNPTPSQIPTPTPS--------MPAIIRVKAEPGLAAVAASSTQTPPASPT----- 499
            :|||||.......||.|...:..        .|.     |..|.||...:|.:.||::.|     
Human   155 SPTLTPGERQQNRPSVITCASAGARNCNLSHCPI-----AHSGCAAPGPASYRRPPSAATTCDPV 214

  Fly   500 ------------------SSTNISIFTKTEASVDDHFAKALGETWKKLQ 530
                              :..::||    ..|||||||||||:||.:::
Human   215 VEEHFRRSLGKNYKEPEPAPNSVSI----TGSVDDHFAKALGDTWLQIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TgiNP_729916.1 VGLL4 <258..297 CDD:291898
TDU 282..297 CDD:197839
TDU 511..526 CDD:197839 11/14 (79%)
VGLL4NP_001121691.1 VGLL4 14..230 CDD:291898 43/209 (21%)
TDU 240..255 CDD:197839 11/14 (79%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110714
Panther 1 1.100 - - LDO PTHR17604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.