DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tgi and vgll4l

DIOPT Version :9

Sequence 1:NP_729916.1 Gene:Tgi / 39521 FlyBaseID:FBgn0036373 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001073467.1 Gene:vgll4l / 562092 ZFINID:ZDB-GENE-070112-1682 Length:266 Species:Danio rerio


Alignment Length:128 Identity:34/128 - (26%)
Similarity:49/128 - (38%) Gaps:46/128 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 APTLTPTPTPNPTPSQIPTPTPSMP------------------------AIIRVKAEPG-LAAVA 487
            :||.|.:||.:|| ..||:|..|.|                        |..:::..|. :..|:
Zfish    88 SPTSTWSPTASPT-HLIPSPVFSSPVMDEPLALIKKPRPEPEKTESQNKATTQIQMRPSVITCVS 151

  Fly   488 ASSTQTPPASPTSSTNISIF--------------------TKTEASVDDHFAKALGETWKKLQ 530
            ::|..|.......||.:|..                    |....|||||||||||:.|.:|:
Zfish   152 SASRSTKQDCCNHSTAVSKHSYDHVEEHFQRSLGINYHRATSISVSVDDHFAKALGDKWLQLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TgiNP_729916.1 VGLL4 <258..297 CDD:291898
TDU 282..297 CDD:197839
TDU 511..526 CDD:197839 11/14 (79%)
vgll4lNP_001073467.1 VGLL4 9..191 CDD:291898 20/103 (19%)
TDU 197..210 CDD:197839 11/12 (92%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR17604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.