DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abp1 and Lasp

DIOPT Version :9

Sequence 1:NP_648657.1 Gene:Abp1 / 39520 FlyBaseID:FBgn0036372 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster


Alignment Length:451 Identity:92/451 - (20%)
Similarity:164/451 - (36%) Gaps:146/451 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 RQEAEKESKRLELQKLE---------QEQRSREEKEHKEREKLVISTTKLQPAHV-PIKTSPQ-- 239
            :|:.:::.:|.:.|:|.         |..|.:::::.:::::|:......|.:|: |..||.|  
  Fly   240 QQQQQQQQQRAQQQQLHDPYAHYQQPQALRQQQQQQQQQQQQLLQQQAIKQASHLYPTATSQQQQ 304

  Fly   240 ------PLSPEKTAPGFANNLTDA----------------ERMRQARNQEARELIGSRVGAAKAM 282
                  |.:|::.|....|.:..|                ::.:|.::|..::.....:.||:..
  Fly   305 MPPPQSPANPQQQALNSYNEMRSAILQNSHHPSGNSVDQYDQPQQQQHQPQQQSTNPTLVAAQQQ 369

  Fly   283 FTKHTSEGQLQSKLNTQPPAKPARNSIAQRINVFNQ---NQPQDAPVPSPPRAASPAKPLPVEAP 344
            .:.|       |.||..  |.....|.:...|:.|.   :|.|..| |...|:|:........:.
  Fly   370 QSHH-------SLLNNN--ASNGGISHSHHSNINNNGHGSQNQMLP-PQMRRSAASVVAYDGNSK 424

  Fly   345 EPVVPAPAIAP-------AAPVAAEVV----------------------------STIAEVEESQ 374
            :.|...|..|.       |:|..|.|.                            |.|.::.:..
  Fly   425 QQVAAGPGAAQNHLQQLYASPNYAAVTPSENSINVKQHASNGHMPNQQQQHVAGGSNIGKIADYD 489

  Fly   375 PVDDLP--LAHESEQFSTIKRSPHSKSN-SLQSQSPDETTSSNETD---------TAVSQ----- 422
            |:.|.|  :.:.....:|:..|...:.| ...|..|....|.::.|         ||..|     
  Fly   490 PLTDGPRVVPNAGRSSTTLVYSSEPRGNQGGNSVYPKRIGSVSDIDPANGIYGSLTAAEQAHQQQ 554

  Fly   423 ------------------EQEEEVRTKVSV-TVQQSQSVKSSGMSTLERNALTDLVNEDDFICQE 468
                              .|::::|.:.|. ::|:.||.:|:.|...                  
  Fly   555 KHQQYYQQVQMMQQQEHPPQQQQMRQQPSYSSLQEKQSRQSTAMRVY------------------ 601

  Fly   469 TLGDLGQRARALYDYQAADETEITFDPGDVITHIDQIDEGWWQG-LGPDGTYGLFPANYVE 528
                     ||:|||:|.|..|::|..||||..::.||.||..| :...|..|:.||||||
  Fly   602 ---------RAIYDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYVE 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abp1NP_648657.1 ADF_drebrin_like 3..138 CDD:200437
DBINO <173..>207 CDD:290603 5/28 (18%)
SH3_Abp1_eu 476..529 CDD:212893 26/54 (48%)
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831
Nebulin 68..94 CDD:279252
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R73
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.