DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abp1 and LASP1

DIOPT Version :9

Sequence 1:NP_648657.1 Gene:Abp1 / 39520 FlyBaseID:FBgn0036372 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_006139.1 Gene:LASP1 / 3927 HGNCID:6513 Length:261 Species:Homo sapiens


Alignment Length:172 Identity:55/172 - (31%)
Similarity:78/172 - (45%) Gaps:15/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 STIAEVEESQPV----DDLPLAHESEQFSTIKRSPHSKSNSLQSQSPDETTSSNETDTAVSQEQE 425
            |.:|:..|.|.:    |.:......|:|...:..| |....::.:..|....|:.. ..:.|:|.
Human    99 SVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGP-SGGEGMEPERRDSQDGSSYR-RPLEQQQP 161

  Fly   426 EEVRTKVSVTVQ-QSQSVKSSGMSTLERNALTDLVNEDDFICQETLGDLGQRARALYDYQAADET 489
            ..:.|...|..| |.|.|..|.....|..|...       |.:...|..|:|.||:|||.||||.
Human   162 HHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVS-------IQRSAPGGGGKRYRAVYDYSAADED 219

  Fly   490 EITFDPGDVITHIDQIDEGWWQG-LGPDGTYGLFPANYVEII 530
            |::|..||.|.::.|||:||..| :...|..|:.||||||.|
Human   220 EVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Abp1NP_648657.1 ADF_drebrin_like 3..138 CDD:200437
DBINO <173..>207 CDD:290603
SH3_Abp1_eu 476..529 CDD:212893 28/53 (53%)
LASP1NP_006139.1 LIM_LASP 5..57 CDD:188831
Nebulin 1 61..95
NEBU 62..92 CDD:128523
Nebulin 2 97..131 7/31 (23%)
NEBU 98..128 CDD:128523 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..186 16/76 (21%)
SH3_Lasp1_C 203..261 CDD:212867 30/57 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R73
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.